PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G221200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 176aa    MW: 18923.1 Da    PI: 4.7046
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G221200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB45.51.8e-14681372695
               NF-YB  26 kiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                          + kda     e +  fi ++++ a+d c++ kr+tin++d++ al ++ f ++vepl++ l+++r+ ++
  Brast05G221200.1.p  68 IVNKDAMAAFAESARIFIHYLSATANDVCKEAKRQTINAEDVFKALDEIEFTEFVEPLRTSLEEFRNKNA 137
                         57899*************************************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-3138174IPR009072Histone-fold
PfamPF008089.9E-940113IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471137.16E-2541171IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MAGETKEPQA ASQGESSKSA APASAPAPAA AAMPEAEVEE LPKTIVRRLV KDKLAQIAGS  60
DEGGADVIVN KDAMAAFAES ARIFIHYLSA TANDVCKEAK RQTINAEDVF KALDEIEFTE  120
FVEPLRTSLE EFRNKNAARR PATGKKPAEK RRKLDKEVPP KDQNNAADDA KEDED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238535.11e-101PREDICTED: DNA polymerase epsilon subunit 3-like
TrEMBLI1IT161e-101I1IT16_BRADI; Uncharacterized protein
STRINGBRADI4G38527.11e-100(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104143744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27470.15e-35nuclear factor Y, subunit B11